PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 326aa    MW: 37490.6 Da    PI: 7.0002
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35961.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.11.3e-26199248352
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ++isl+dl kyF +pi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  KHN35961.1 199 AKISLSDLVKYFGMPIVEASRNLNVGLTVLKRKCREFGIPRWPHRKIKSL 248
                 589*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.645183268IPR003035RWP-RK domain
PfamPF020421.1E-21201248IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MESTLLTNLL VFNNTLQPEL MRSVHVYRRG DGEKREVERE FVFSESGSYG EMQATPIPGL  60
VKSRVSEVCE GHRNGVWLCV FAFHADHTPQ FCRIPPVLLV TRNPKLKMIP NLLDDLHVIY  120
KLDRKEEDSD IAQDYTGEER QGNSNNCQPS WKVFPVLDQD LNCLPYEDDE SESLDNETDV  180
ESSPGLLAKK KRAPSDLVAK ISLSDLVKYF GMPIVEASRN LNVGLTVLKR KCREFGIPRW  240
PHRKIKSLDS LIHDLQEEVK SQELEDREAA LAVAKRQRML ESEKENIEKK PFMDIQSETK  300
RFRQDVFKRR HRARAVGKHN STVSST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0903770.0BT090377.1 Soybean clone JCVI-FLGm-4G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517135.20.0PREDICTED: uncharacterized protein LOC100795946
TrEMBLA0A0B2RN570.0A0A0B2RN57_GLYSO; Protein RKD5
TrEMBLI1J8D10.0I1J8D1_SOYBN; Uncharacterized protein
STRINGGLYMA01G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-85RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]